Anti-MCCC1

Catalog Number: ATA-HPA071630
Article Name: Anti-MCCC1
Biozol Catalog Number: ATA-HPA071630
Supplier Catalog Number: HPA071630
Alternative Catalog Number: ATA-HPA071630-100,ATA-HPA071630-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MCCA, MCCCalpha
Clonality: Polyclonal
Concentration: 0,05
NCBI: 56922
UniProt: Q96RQ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLLSRKAAAKESLCQAALGLILKEKAMTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKNNVAIAVTYNHDGSYSMQIEDKTF
Target: MCCC1
HPA071630-100ul