Anti-DMKN

Catalog Number: ATA-HPA071641
Article Name: Anti-DMKN
Biozol Catalog Number: ATA-HPA071641
Supplier Catalog Number: HPA071641
Alternative Catalog Number: ATA-HPA071641-100,ATA-HPA071641-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ZD52F10
Clonality: Polyclonal
Concentration: 0,2
NCBI: 93099
UniProt: Q6E0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: STGTNIGEALGHGLGDALSEGVGKAIGKEAGGAAGSKVSEALGQGTREAVGTGVRQVPGFGAADALGNRVGEAAHALGNTGHEIGRQAEDVIRHGADAVRGSWQGVPGHNGAWETSGGHGIFGSQG
Target: DMKN
HPA071641-100ul