Anti-NKAPL

Catalog Number: ATA-HPA071697
Article Name: Anti-NKAPL
Biozol Catalog Number: ATA-HPA071697
Supplier Catalog Number: HPA071697
Alternative Catalog Number: ATA-HPA071697-100,ATA-HPA071697-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bA424I5.1, C6orf194
Clonality: Polyclonal
Concentration: 0,05
NCBI: 222698
UniProt: Q5M9Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KDSEEDLSEATWMEQPNVADTMDLIGPEAPIIHTSQD
Target: NKAPL
HPA071697-100ul