Anti-SORCS2

Catalog Number: ATA-HPA071818
Article Name: Anti-SORCS2
Biozol Catalog Number: ATA-HPA071818
Supplier Catalog Number: HPA071818
Alternative Catalog Number: ATA-HPA071818-100,ATA-HPA071818-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA1329
Clonality: Polyclonal
Concentration: 0,1
NCBI: 57537
UniProt: Q96PQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSMDMNGKPTNCKPPDCHLHLHLRWADNPYVSGTVHTKDTAPGLIMGAGNLGSQLVEYKEEMYITSDCGHT
Target: SORCS2
HPA071818-100ul