Anti-DCTN1

Catalog Number: ATA-HPA071875
Article Name: Anti-DCTN1
Biozol Catalog Number: ATA-HPA071875
Supplier Catalog Number: HPA071875
Alternative Catalog Number: ATA-HPA071875-100,ATA-HPA071875-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 1639
UniProt: Q14203
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALYRKTSQLLETLNQLSTHTHVVDITRTSPAAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRPGATV
Target: DCTN1
Antibody Type: Monoclonal Antibody
HPA071875-100ul