Anti-EPC1
Catalog Number:
ATA-HPA071891
| Article Name: |
Anti-EPC1 |
| Biozol Catalog Number: |
ATA-HPA071891 |
| Supplier Catalog Number: |
HPA071891 |
| Alternative Catalog Number: |
ATA-HPA071891-100,ATA-HPA071891-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
WB |
| Species Reactivity: |
Human |
| Alternative Names: |
Epl1 |
| Rabbit Polyclonal EPC1 Antibody against Human enhancer of polycomb homolog 1. Validated for Western Blot |
| Clonality: |
Polyclonal |
| Concentration: |
0.2 |
| NCBI: |
80314 |
| UniProt: |
Q9H2F5 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Sequence: |
QFAASALVTSEQLMGFKMKDDVVLGIGVNGVLPASGVYKGLHLSSTTPTALVHTSPSTAGS |
![]()
|
WB Image Caption 1 |
