Anti-ZMIZ2

Catalog Number: ATA-HPA071991
Article Name: Anti-ZMIZ2
Biozol Catalog Number: ATA-HPA071991
Supplier Catalog Number: HPA071991
Alternative Catalog Number: ATA-HPA071991-100,ATA-HPA071991-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp761I2123, hZIMP7, KIAA1886, NET27, ZIMP7
Clonality: Polyclonal
Concentration: 0,05
NCBI: 83637
UniProt: Q8NF64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SEVYPGQQYLQGGQYAPSTAQFAPSPGQPPAPSPSYPGHRLPLQQGMTQSLSVPGPTGLHYKPTEQFNGQ
Target: ZMIZ2
HPA071991-100ul