Anti-STAU1

Catalog Number: ATA-HPA072004
Article Name: Anti-STAU1
Biozol Catalog Number: ATA-HPA072004
Supplier Catalog Number: HPA072004
Alternative Catalog Number: ATA-HPA072004-100,ATA-HPA072004-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: PPP1R150, STAU
Clonality: Polyclonal
Isotype: IgG
NCBI: 6780
UniProt: O95793
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGKGKTRQAAKHDAAAKA
Target: STAU1
Antibody Type: Monoclonal Antibody
HPA072004-100ul