Anti-TOP3B

Catalog Number: ATA-HPA072114
Article Name: Anti-TOP3B
Biozol Catalog Number: ATA-HPA072114
Supplier Catalog Number: HPA072114
Alternative Catalog Number: ATA-HPA072114-100,ATA-HPA072114-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 8940
UniProt: O95985
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TIKLYKELRCPLDDFELVLWSSGSRGKSYPLCPYCYNHPPFRDMKKGMGCNECTHPSCQHSLSMLGIGQCVECESGVLVLDPTSGPKWKVACNKCNVV
Target: TOP3B
Antibody Type: Monoclonal Antibody
HPA072114-100ul