Anti-CCN5

Catalog Number: ATA-HPA072121
Article Name: Anti-CCN5
Biozol Catalog Number: ATA-HPA072121
Supplier Catalog Number: HPA072121
Alternative Catalog Number: ATA-HPA072121-100,ATA-HPA072121-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CT58, CTGF-L, WISP-2, WISP2
Clonality: Polyclonal
Concentration: 0,4
NCBI: 8839
UniProt: O76076
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSA
Target: CCN5
HPA072121-100ul