Anti-KCNH5

Catalog Number: ATA-HPA072351
Article Name: Anti-KCNH5
Biozol Catalog Number: ATA-HPA072351
Supplier Catalog Number: HPA072351
Alternative Catalog Number: ATA-HPA072351-100,ATA-HPA072351-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: eag2, H-EAG2, Kv10.2
Clonality: Polyclonal
Isotype: IgG
NCBI: 27133
UniProt: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Target: KCNH5
Antibody Type: Monoclonal Antibody
HPA072351-100ul