Anti-SLC26A6

Catalog Number: ATA-HPA072381
Article Name: Anti-SLC26A6
Biozol Catalog Number: ATA-HPA072381
Supplier Catalog Number: HPA072381
Alternative Catalog Number: ATA-HPA072381-100,ATA-HPA072381-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp586E1422
Clonality: Polyclonal
Concentration: 0,3
NCBI: 65010
UniProt: Q9BXS9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DATANGQEDSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFREIEVEVYMAACHSPVVSQLEAGHFFDASITKKHL
Target: SLC26A6
HPA072381-100ul