Anti-CTSA

Catalog Number: ATA-HPA072487
Article Name: Anti-CTSA
Biozol Catalog Number: ATA-HPA072487
Supplier Catalog Number: HPA072487
Alternative Catalog Number: ATA-HPA072487-100,ATA-HPA072487-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GSL, PPGB
Clonality: Polyclonal
Isotype: IgG
NCBI: 5476
UniProt: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT
Target: CTSA
Antibody Type: Monoclonal Antibody
HPA072487-100ul