Anti-PLA2G4E

Catalog Number: ATA-HPA072562
Article Name: Anti-PLA2G4E
Biozol Catalog Number: ATA-HPA072562
Supplier Catalog Number: HPA072562
Alternative Catalog Number: ATA-HPA072562-100,ATA-HPA072562-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: FLJ45651
Clonality: Polyclonal
Concentration: 0,05
NCBI: 123745
UniProt: Q3MJ16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KDLLVMVNESFENTQRVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCRSRKKGPISQPLDCLSDGQVMTLPVGESYELHMKSTPCPE
Target: PLA2G4E
HPA072562-100ul