Anti-MYOCD

Catalog Number: ATA-HPA072582
Article Name: Anti-MYOCD
Biozol Catalog Number: ATA-HPA072582
Supplier Catalog Number: HPA072582
Alternative Catalog Number: ATA-HPA072582-100,ATA-HPA072582-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MYCD
Clonality: Polyclonal
Isotype: IgG
NCBI: 93649
UniProt: Q8IZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VSSPISSQVCTAQNSGAHDGHPPSFSPHSSSLHPPFSGAQADSSHGAGGNPCPKSPCVQQKMAGLHSSDKVGPKFSIPS
Target: MYOCD
Antibody Type: Monoclonal Antibody
HPA072582-100ul