Anti-DNASE1L1

Catalog Number: ATA-HPA072635
Article Name: Anti-DNASE1L1
Biozol Catalog Number: ATA-HPA072635
Supplier Catalog Number: HPA072635
Alternative Catalog Number: ATA-HPA072635-100,ATA-HPA072635-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Molekularbiologie
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DNAS1L1, DNASEX, DNL1L, XIB
deoxyribonuclease I-like 1
Anti-DNASE1L1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 1774
UniProt: P49184
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: DNASE1L1
Antibody Type: Monoclonal Antibody
Application Dilute: IHC: 1:1000 - 1:2500
Immunohistochemical staining of human bronchus shows membranous positivity in respiratory epithelial cells.
HPA072635-100ul