Anti-HSPG2

Catalog Number: ATA-HPA072690
Article Name: Anti-HSPG2
Biozol Catalog Number: ATA-HPA072690
Supplier Catalog Number: HPA072690
Alternative Catalog Number: ATA-HPA072690-100,ATA-HPA072690-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: perlecan, PRCAN, SJS1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3339
UniProt: P98160
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL
Target: HSPG2
Antibody Type: Monoclonal Antibody
HPA072690-100ul