Anti-SCN7A

Catalog Number: ATA-HPA072715
Article Name: Anti-SCN7A
Biozol Catalog Number: ATA-HPA072715
Supplier Catalog Number: HPA072715
Alternative Catalog Number: ATA-HPA072715-100,ATA-HPA072715-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NaG, Nav2.1, Nav2.2, SCN6A
Clonality: Polyclonal
Isotype: IgG
NCBI: 6332
UniProt: Q01118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
Target: SCN7A
Antibody Type: Monoclonal Antibody
HPA072715-100ul