Anti-MTA2

Catalog Number: ATA-HPA072727
Article Name: Anti-MTA2
Biozol Catalog Number: ATA-HPA072727
Supplier Catalog Number: HPA072727
Alternative Catalog Number: ATA-HPA072727-100,ATA-HPA072727-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MTA1-L1, MTA1L1
Clonality: Polyclonal
Isotype: IgG
NCBI: 9219
UniProt: O94776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK
Target: MTA2
Antibody Type: Monoclonal Antibody
HPA072727-100ul