Anti-STK31

Catalog Number: ATA-HPA072896
Article Name: Anti-STK31
Biozol Catalog Number: ATA-HPA072896
Supplier Catalog Number: HPA072896
Alternative Catalog Number: ATA-HPA072896-100,ATA-HPA072896-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SgK396, TDRD8
Clonality: Polyclonal
Concentration: 0,1
NCBI: 56164
UniProt: Q9BXU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DTHYDKVEDVVGSHIEDAVTFWAQSINRNKDIMKIGCSLSEVCPQASSVLGNLDPNKIYGGLFSEDQCWYRCKVLKIISVEKCLVRYIDYGNTEILNRSDIVEIPLELQFSSVAKKYKLWGLH
Target: STK31
HPA072896-100ul