Anti-GSDMC

Catalog Number: ATA-HPA072904
Article Name: Anti-GSDMC
Biozol Catalog Number: ATA-HPA072904
Supplier Catalog Number: HPA072904
Alternative Catalog Number: ATA-HPA072904-100,ATA-HPA072904-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MLZE
Clonality: Polyclonal
Concentration: 0,05
NCBI: 56169
UniProt: Q9BYG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSL
Target: GSDMC
HPA072904-100ul