Anti-ERICH3

Catalog Number: ATA-HPA072916
Article Name: Anti-ERICH3
Biozol Catalog Number: ATA-HPA072916
Supplier Catalog Number: HPA072916
Alternative Catalog Number: ATA-HPA072916-100,ATA-HPA072916-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C1orf173, DKFZp547I048, RP11-653A5.1
Clonality: Polyclonal
Isotype: IgG
NCBI: 127254
UniProt: Q5RHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GLEPLLTKDSRRIHKTSLHSNAAITMIYLGKNVHLSSDNPDFRDEIKVYQQHCGGENLCVYKGKLLEKETFQFISKRHHGFPFSLTFFLNGMQVNRLSSCCE
Target: ERICH3
Antibody Type: Monoclonal Antibody
HPA072916-100ul