Anti-NEDD9

Catalog Number: ATA-HPA072955
Article Name: Anti-NEDD9
Biozol Catalog Number: ATA-HPA072955
Supplier Catalog Number: HPA072955
Alternative Catalog Number: ATA-HPA072955-100,ATA-HPA072955-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CAS-L, CASS2, HEF1
Clonality: Polyclonal
Isotype: IgG
NCBI: 4739
UniProt: Q14511
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Target: NEDD9
Antibody Type: Monoclonal Antibody
HPA072955-100ul