Anti-NRIP3

Catalog Number: ATA-HPA072961
Article Name: Anti-NRIP3
Biozol Catalog Number: ATA-HPA072961
Supplier Catalog Number: HPA072961
Alternative Catalog Number: ATA-HPA072961-100,ATA-HPA072961-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C11orf14
Clonality: Polyclonal
Isotype: IgG
NCBI: 56675
UniProt: Q9NQ35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRLDCPAAVVDDNEKNLSLGLQT
Target: NRIP3
Antibody Type: Monoclonal Antibody
HPA072961-100ul