Anti-FERMT2

Catalog Number: ATA-HPA072965
Article Name: Anti-FERMT2
Biozol Catalog Number: ATA-HPA072965
Supplier Catalog Number: HPA072965
Alternative Catalog Number: ATA-HPA072965-100,ATA-HPA072965-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIND2, mig-2, PLEKHC1, UNC112B
Clonality: Polyclonal
Isotype: IgG
NCBI: 10979
UniProt: Q96AC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQALLDK
Target: FERMT2
Antibody Type: Monoclonal Antibody
HPA072965-100ul