Anti-PTF1A

Catalog Number: ATA-HPA073033
Article Name: Anti-PTF1A
Biozol Catalog Number: ATA-HPA073033
Supplier Catalog Number: HPA073033
Alternative Catalog Number: ATA-HPA073033-100,ATA-HPA073033-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: bHLHa29, p48, PTF1-p48
Clonality: Polyclonal
Concentration: 0,1
NCBI: 256297
UniProt: Q7RTS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: LLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYR
Target: PTF1A
HPA073033-100ul