Anti-C11orf53

Catalog Number: ATA-HPA073101
Article Name: Anti-C11orf53
Biozol Catalog Number: ATA-HPA073101
Supplier Catalog Number: HPA073101
Alternative Catalog Number: ATA-HPA073101-100,ATA-HPA073101-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC50104
Clonality: Polyclonal
Isotype: IgG
NCBI: 341032
UniProt: Q8IXP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VTSGYYGVRRSFLSDSDFHNSKQFSNDVYTSSVGKPFPCESSAGQSHAALLEPYFPQEPYGDYRPPALTPNAGSLFS
Target: C11orf53
Antibody Type: Monoclonal Antibody
HPA073101-100ul