Anti-ESPL1

Catalog Number: ATA-HPA073188
Article Name: Anti-ESPL1
Biozol Catalog Number: ATA-HPA073188
Supplier Catalog Number: HPA073188
Alternative Catalog Number: ATA-HPA073188-100,ATA-HPA073188-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ESP1, KIAA0165, SEPA
Clonality: Polyclonal
Isotype: IgG
NCBI: 9700
UniProt: Q14674
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTKLQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQKGKQQAQVPCPPQLPEEELFLRGPALELVA
Target: ESPL1
Antibody Type: Monoclonal Antibody
HPA073188-100ul