Anti-TPO

Catalog Number: ATA-HPA073226
Article Name: Anti-TPO
Biozol Catalog Number: ATA-HPA073226
Supplier Catalog Number: HPA073226
Alternative Catalog Number: ATA-HPA073226-100,ATA-HPA073226-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TPX
Clonality: Polyclonal
Concentration: 0,3
NCBI: 7173
UniProt: P07202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: STVICRWTRTGTKSTLPISETGGGTPELRCGKHQAVGTSPQRAAAQDSEQESAGMEGRDTHRLPRA
Target: TPO
HPA073226-100ul