Anti-RAD21
Catalog Number:
ATA-HPA073277
| Article Name: |
Anti-RAD21 |
| Biozol Catalog Number: |
ATA-HPA073277 |
| Supplier Catalog Number: |
HPA073277 |
| Alternative Catalog Number: |
ATA-HPA073277-100,ATA-HPA073277-25 |
| Manufacturer: |
Atlas Antibodies |
| Host: |
Rabbit |
| Category: |
Sonstiges |
| Application: |
ICC |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: |
Unconjugated |
| Alternative Names: |
hHR21, KIAA0078, SCC1 |
| Clonality: |
Polyclonal |
| Concentration: |
0,2 |
| NCBI: |
5885 |
| UniProt: |
O60216 |
| Buffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: |
MDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTK |
| Target: |
RAD21 |
![]()
|
HPA073277-100ul |
