Anti-ROM1

Catalog Number: ATA-HPA073279
Article Name: Anti-ROM1
Biozol Catalog Number: ATA-HPA073279
Supplier Catalog Number: HPA073279
Alternative Catalog Number: ATA-HPA073279-100,ATA-HPA073279-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ROM, TSPAN23
Clonality: Polyclonal
Isotype: IgG
NCBI: 6094
UniProt: Q03395
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA
Target: ROM1
Antibody Type: Monoclonal Antibody
HPA073279-100ul