Anti-FAM240C

Catalog Number: ATA-HPA073342
Article Name: Anti-FAM240C
Biozol Catalog Number: ATA-HPA073342
Supplier Catalog Number: HPA073342
Alternative Catalog Number: ATA-HPA073342-100,ATA-HPA073342-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 285095
UniProt: A0A1B0GVR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: RSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA
Target: FAM240C
Antibody Type: Monoclonal Antibody
HPA073342-100ul