Anti-TGFB1

Catalog Number: ATA-HPA073356
Article Name: Anti-TGFB1
Biozol Catalog Number: ATA-HPA073356
Supplier Catalog Number: HPA073356
Alternative Catalog Number: ATA-HPA073356-100,ATA-HPA073356-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CED, DPD1, TGFB, TGFbeta
Clonality: Polyclonal
Isotype: IgG
NCBI: 7040
UniProt: P01137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR
Target: TGFB1
Antibody Type: Monoclonal Antibody
HPA073356-100ul