Anti-IL27RA

Catalog Number: ATA-HPA073441
Article Name: Anti-IL27RA
Biozol Catalog Number: ATA-HPA073441
Supplier Catalog Number: HPA073441
Alternative Catalog Number: ATA-HPA073441-100,ATA-HPA073441-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CRL1, IL-27R, TCCR, WSX-1, WSX1, zcytor1
Clonality: Polyclonal
Isotype: IgG
NCBI: 9466
UniProt: Q6UWB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: QCYGVGPLGDLNCSWEPLGDLGAPSELHLQSQKYRSNKTQTVAVAAGRSWVAIPREQLTMSDKLLVWGTKAGQPLWPPVFVNL
Target: IL27RA
Antibody Type: Monoclonal Antibody
HPA073441-100ul