Anti-FOXK2

Catalog Number: ATA-HPA073491
Article Name: Anti-FOXK2
Biozol Catalog Number: ATA-HPA073491
Supplier Catalog Number: HPA073491
Alternative Catalog Number: ATA-HPA073491-100,ATA-HPA073491-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ILF, ILF1
Clonality: Polyclonal
Isotype: IgG
NCBI: 3607
UniProt: Q01167
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVRE
Target: FOXK2
Antibody Type: Monoclonal Antibody
HPA073491-100ul