Anti-DIO3

Catalog Number: ATA-HPA073684
Article Name: Anti-DIO3
Biozol Catalog Number: ATA-HPA073684
Supplier Catalog Number: HPA073684
Alternative Catalog Number: ATA-HPA073684-100,ATA-HPA073684-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: TXDI3
Clonality: Polyclonal
Isotype: IgG
NCBI: 1735
UniProt: P55073
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: IRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFF
Target: DIO3
Antibody Type: Monoclonal Antibody
HPA073684-100ul