Anti-ELANE

Catalog Number: ATA-HPA073774
Article Name: Anti-ELANE
Biozol Catalog Number: ATA-HPA073774
Supplier Catalog Number: HPA073774
Alternative Catalog Number: ATA-HPA073774-100,ATA-HPA073774-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ELA2, HLE, HNE, NE, PMN-E
Clonality: Polyclonal
Concentration: 0,1
NCBI: 1991
UniProt: P08246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVILQLNGSATINANV
Target: ELANE
HPA073774-100ul