Anti-NXPH3

Catalog Number: ATA-HPA073819
Article Name: Anti-NXPH3
Biozol Catalog Number: ATA-HPA073819
Supplier Catalog Number: HPA073819
Alternative Catalog Number: ATA-HPA073819-100,ATA-HPA073819-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: NPH3
Clonality: Polyclonal
Isotype: IgG
NCBI: 11248
UniProt: O95157
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: GPPGSEDPERDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPNRPNH
Target: NXPH3
Antibody Type: Monoclonal Antibody
HPA073819-100ul