Anti-IFNB1

Catalog Number: ATA-HPA073843
Article Name: Anti-IFNB1
Biozol Catalog Number: ATA-HPA073843
Supplier Catalog Number: HPA073843
Alternative Catalog Number: ATA-HPA073843-100,ATA-HPA073843-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: IFB, IFF, IFNB
Clonality: Polyclonal
Isotype: IgG
NCBI: 3456
UniProt: P01574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: YNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
Target: IFNB1
Antibody Type: Monoclonal Antibody
HPA073843-100ul