Anti-ETV5

Catalog Number: ATA-HPA073889
Article Name: Anti-ETV5
Biozol Catalog Number: ATA-HPA073889
Supplier Catalog Number: HPA073889
Alternative Catalog Number: ATA-HPA073889-100,ATA-HPA073889-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: ERM
Clonality: Polyclonal
Isotype: IgG
NCBI: 2119
UniProt: P41161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ
Target: ETV5
Antibody Type: Monoclonal Antibody
HPA073889-100ul