Anti-OSBPL7

Catalog Number: ATA-HPA073967
Article Name: Anti-OSBPL7
Biozol Catalog Number: ATA-HPA073967
Supplier Catalog Number: HPA073967
Alternative Catalog Number: ATA-HPA073967-100,ATA-HPA073967-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: MGC71150, ORP7
Clonality: Polyclonal
Isotype: IgG
NCBI: 114881
UniProt: Q9BZF2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ESLHRIPSAPVIPTHQASVTTERPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDSSGTRGLPPTDYAHLQRSFWALAQKVHSSL
Target: OSBPL7
Antibody Type: Monoclonal Antibody
HPA073967-100ul