Anti-OSCAR

Catalog Number: ATA-HPA073996
Article Name: Anti-OSCAR
Biozol Catalog Number: ATA-HPA073996
Supplier Catalog Number: HPA073996
Alternative Catalog Number: ATA-HPA073996-100,ATA-HPA073996-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Clonality: Polyclonal
Isotype: IgG
NCBI: 126014
UniProt: Q8IYS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: VGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYH
Target: OSCAR
Antibody Type: Monoclonal Antibody
HPA073996-100ul