Anti-JMJD6

Catalog Number: ATA-HPA074031
Article Name: Anti-JMJD6
Biozol Catalog Number: ATA-HPA074031
Supplier Catalog Number: HPA074031
Alternative Catalog Number: ATA-HPA074031-100,ATA-HPA074031-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: KIAA0585, PTDSR, PTDSR1
Clonality: Polyclonal
Concentration: 0,3
NCBI: 23210
UniProt: Q6NYC1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA
Target: JMJD6
HPA074031-100ul