Anti-CMYA5

Catalog Number: ATA-HPA074081
Article Name: Anti-CMYA5
Biozol Catalog Number: ATA-HPA074081
Supplier Catalog Number: HPA074081
Alternative Catalog Number: ATA-HPA074081-100,ATA-HPA074081-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: C5orf10, DKFZp451G223, myospryn, SPRYD2, TRIM76
Clonality: Polyclonal
Isotype: IgG
NCBI: 202333
UniProt: Q8N3K9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: SDVPKQSVLVSKHHLEAAEDTRVKEPLSSAKSNYAQFISNTSASNADKMVSNKEMPKEPEDTYAKGEDFTVTSKPAGLS
Target: CMYA5
Antibody Type: Monoclonal Antibody
HPA074081-100ul