Anti-DDT

Catalog Number: ATA-HPA074115
Article Name: Anti-DDT
Biozol Catalog Number: ATA-HPA074115
Supplier Catalog Number: HPA074115
Alternative Catalog Number: ATA-HPA074115-100,ATA-HPA074115-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DDCT
Clonality: Polyclonal
Isotype: IgG
NCBI: 1652
UniProt: P30046
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDN
Target: DDT
Antibody Type: Monoclonal Antibody
HPA074115-100ul