Anti-ARRDC2

Catalog Number: ATA-HPA074216
Article Name: Anti-ARRDC2
Biozol Catalog Number: ATA-HPA074216
Supplier Catalog Number: HPA074216
Alternative Catalog Number: ATA-HPA074216-100,ATA-HPA074216-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: CLONE24945, PP2703
Clonality: Polyclonal
Isotype: IgG
NCBI: 27106
UniProt: Q8TBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
Target: ARRDC2
Antibody Type: Monoclonal Antibody
HPA074216-100ul