Anti-GALNS

Catalog Number: ATA-HPA074225
Article Name: Anti-GALNS
Biozol Catalog Number: ATA-HPA074225
Supplier Catalog Number: HPA074225
Alternative Catalog Number: ATA-HPA074225-100,ATA-HPA074225-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GALNAC6S, GAS
Clonality: Polyclonal
Isotype: IgG
NCBI: 2588
UniProt: P34059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: ALDFIKRQARHHPFFLYWAVDATHAPVYASKPFLGTSQRGRYGDAVREIDDSIGKILELLQDLHVADNTFVFFTSDNGAALISAPEQGGSNGPFLCGKQT
Target: GALNS
Antibody Type: Monoclonal Antibody
HPA074225-100ul