Anti-DNAAF1
Catalog Number:
ATA-HPA074239
- Images (6)
| Article Name: | Anti-DNAAF1 |
| Biozol Catalog Number: | ATA-HPA074239 |
| Supplier Catalog Number: | HPA074239 |
| Alternative Catalog Number: | ATA-HPA074239-100,ATA-HPA074239-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Molekularbiologie |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CILD13, FLJ25330, LRRC50, ODA7, swt |
| dynein axonemal assembly factor 1 |
| Anti-DNAAF1 |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 123872 |
| UniProt: | Q8NEP3 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SLEDQNMCFPKIEVISSLSDDSDPELDYTSLPVLENLPTDTLSNIFAVSKDTSKAARVPFTDIFK |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DNAAF1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human testis and prostate tissues using Anti-DNAAF1 antibody. Corresponding DNAAF1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
HPA074239-100ul |
|
|
HPA074239-100ul |
|
|
HPA074239-100ul |
Product Guarantee and Expert Support
