Anti-SYT12

Catalog Number: ATA-HPA074255
Article Name: Anti-SYT12
Biozol Catalog Number: ATA-HPA074255
Supplier Catalog Number: HPA074255
Alternative Catalog Number: ATA-HPA074255-100,ATA-HPA074255-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: SRG1
Clonality: Polyclonal
Isotype: IgG
NCBI: 91683
UniProt: Q8IV01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: FESCFMRVSLLPDEQIVGISRIQRNAYSIFFDEKFSIPLDPTALEEKSLRFSVFGIDEDERNVSTGVVELKLSVLDLPLQPFSGWLYLQDQNKAADA
Target: SYT12
Antibody Type: Monoclonal Antibody
HPA074255-100ul