Anti-POLR3G

Catalog Number: ATA-HPA074330
Article Name: Anti-POLR3G
Biozol Catalog Number: ATA-HPA074330
Supplier Catalog Number: HPA074330
Alternative Catalog Number: ATA-HPA074330-100,ATA-HPA074330-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Sonstiges
Application: ICC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: RPC32, RPC7
Clonality: Polyclonal
Isotype: IgG
NCBI: 10622
UniProt: O15318
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDV
Target: POLR3G
Antibody Type: Monoclonal Antibody
HPA074330-100ul